PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009149453.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 518aa    MW: 58896.2 Da    PI: 5.9719
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009149453.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox314.3e-103664031954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  XP_009149453.1 366 FEHflHPYPKESEKMMLAKQTGLSKNQVANWFINARVR 403
                     664459******************************88 PP

2BELL113.41.2e-36222293172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqelq+kk+kLl++++eVdkrY+qy++q+++++ssFe+vag gsak+YtslAl++iS +Fr+L+dai+eqi
  XP_009149453.1 222 ERQELQNKKNKLLTMVDEVDKRYNQYYHQMEALASSFEIVAGFGSAKSYTSLALNKISCSFRSLRDAIKEQI 293
                     79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.5E-47156291IPR006563POX domain
PfamPF075261.6E-44163289IPR006563POX domain
PROSITE profilePS5007112.6344407IPR001356Homeobox domain
CDDcd000864.93E-11347408No hitNo description
SMARTSM003892.0E-9347411IPR001356Homeobox domain
SuperFamilySSF466894.28E-17348412IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-27350411IPR009057Homeodomain-like
PfamPF059208.8E-18364403IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MAVYYSSNAN CYQQEPIYLD HQQQQQQASS SSAVAAASFV GENVRNEMVF IPPTTGLQTL  60
NGEVTRNGAV SGNDLSFYDG QGLSLSLGNQ ISLPSFHHQQ YHHLGFTPNP SISVKETSPF  120
DVEEKSKEMM LLLGQSNPSS GYAGLYSNYR FNETSGGFMS SFLRSRYLKP AQNLLDEVVS  180
VKKELNQMRK KKQKGEEDFN NGSKDTQGEL STDSNVKLST IERQELQNKK NKLLTMVDEV  240
DKRYNQYYHQ MEALASSFEI VAGFGSAKSY TSLALNKISC SFRSLRDAIK EQIQIIREKL  300
GEKGGGGESL DEQQGGGERI PRLRYLDQRL RQQRAFHQQL GMVRPSWRPQ RGLPENSVSV  360
LRAWLFEHFL HPYPKESEKM MLAKQTGLSK NQVANWFINA RVRLWKPMIE DIYKEEFGDE  420
SELQISKSSQ ELNSTNQDDS SSQQQQGDNN NNLGYPSADT TNINDKPQQE QEMNRSGDYE  480
TLMNYQGFGL EEEYRYMGGN NQEDSRFSNA HHLHDFVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16353410562Homeobox protein Meis2
3k2a_B4e-16353410562Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.191862e-47bud| flower
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895580.0AC189558.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH006P24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149453.10.0PREDICTED: BEL1-like homeodomain protein 10
RefseqXP_009149454.10.0PREDICTED: BEL1-like homeodomain protein 10
RefseqXP_009149455.10.0PREDICTED: BEL1-like homeodomain protein 10
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLA0A0D3CBK80.0A0A0D3CBK8_BRAOL; Uncharacterized protein
STRINGBra025758.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.30.0BEL1-like homeodomain 10